Recombinant HIV-1 gp41 Long (aa 444-833)

Cat. No.:

CSI15805B pdf (datasheet)

Quantity/Size:

0.5 mg

Price:

$1,095.00 BUY

Description:

Human immunodeficiency virus (HIV) is a retrovirus that can lead to a condition in which the immune system begins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the human immune system such as helper T cells(specifically CD4+ T cells), macrophages and dendritic cells. Once the virus has infected the cell, two pathways are possible: either the virus becomes latent and the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosis in infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytes that recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunities lost, and the body becomes progressively more susceptible to opportunistic infections.

The E. coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.

Data PDF:

CSI15805

Physical State:

Liquid

Formulation:

Sterile filtered, 8 M Urea, 20 mM Tris-HCl, pH 8.0, 10 mM β-mercaptoethanol

Purity:

> 95.0% as determined by HPLC & SDS-PAGE.

Biological Activity:

Immunoreactive with all sera of HIV-1 infected individuals.

Amino Acid Sequence:

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL

Storage/Stability:

HIV-1 gp41 Long although stable at 2-8°C for 1 week, should be stored in working aliquots at -20°C to -80°C.